SLC39A12 Antibody - Azide and BSA Free

Western Blot: SLC39A12 Antibody [NBP2-93599] - Analysis of extracts of various cell lines, using SLC39A12 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC39A12 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SLC39A12 Antibody - Azide and BSA Free (NBP2-93599) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1). MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC39A12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500-1:2000
• Theoretical MW: 77 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC39A12 Antibody - Azide and BSA Free

• bA570F3.1
• FLJ30499
• LIV-1 subfamily of ZIP zinc transporter 8
• LZT-Hs8
• MGC43205
• MGC51099
• solute carrier family 39 (metal ion transporter), member 12
• solute carrier family 39 (zinc transporter), member 12
• Solute carrier family 39 member 12
• zinc transporter ZIP12
• ZIP12
• ZIP-12
• Zrt- and Irt-like protein 12

Background

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipidmetabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson,2003 (PubMed 12659941)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC39A12