SLC39A11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC39A11 Antibody [NBP2-58224] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC39A11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFW
Specificity
Specificity of human SLC39A11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC39A11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC39A11 Recombinant Protein Antigen (NBP2-58224PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC39A11 Antibody

  • C17orf26
  • chromosome 17 open reading frame 26
  • solute carrier family 39 (metal ion transporter), member 11
  • Solute carrier family 39 member 11
  • zinc transporter ZIP11
  • ZIP11
  • ZIP-11
  • Zrt- and Irt-like protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-83813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76504
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP1-56937
Species: Hu
Applications: WB
NBP1-03077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
NBP1-69296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34058
Species: Hu
Applications: IHC, IHC-P
NBP2-80523
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76507
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-86829
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06015
Species: Hu

Publications for SLC39A11 Antibody (NBP2-58224) (0)

There are no publications for SLC39A11 Antibody (NBP2-58224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC39A11 Antibody (NBP2-58224) (0)

There are no reviews for SLC39A11 Antibody (NBP2-58224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC39A11 Antibody (NBP2-58224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC39A11 Products

Bioinformatics Tool for SLC39A11 Antibody (NBP2-58224)

Discover related pathways, diseases and genes to SLC39A11 Antibody (NBP2-58224). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SLC39A11

There are no specific blogs for SLC39A11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC39A11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC39A11