SLC36A4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC36A4 Antibody [NBP1-81931] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC36A4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC36A4 Antibody - BSA Free (NBP1-81931) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-SLC36A4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC36A4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC36A4 Protein (NBP1-81931PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC36A4 Antibody - BSA Free

• proton/amino acid transporter 4
• solute carrier family 36 (proton/amino acid symporter), member 4

Background

SLC36A4 is a gene that codes for a protein with two isoforms, measuring 504 and 369 amino acids in length, with weights of approximately 56 and 41 kDa respectively. The protein encoded by SLC36A4 functions as a sodium-independent electroneutral transporter for proline, tryptophan, and alanine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC36A4 Antibody (NBP1-81931)(1)

Publication using NBP1-81931

Bioinformatics

• Gene Symbol: SLC36A4