SLC36A4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC36A4 Antibody [NBP1-81931] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining in human cerebral cortex and duodenum tissues using anti-SLC36A4 antibody. Corresponding SLC36A4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human duodenum shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC36A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGL
Specificity
Specificity of human SLC36A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC36A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC36A4 Protein (NBP1-81931PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC36A4 Antibody

  • proton/amino acid transporter 4
  • solute carrier family 36 (proton/amino acid symporter), member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP1-92401
Species: Hu
Applications: WB, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-04891
Species: Hu
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
366-6C/CF
Species: Hu
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM, ICC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-81931
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC36A4 Antibody (NBP1-81931) (0)

There are no publications for SLC36A4 Antibody (NBP1-81931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC36A4 Antibody (NBP1-81931) (0)

There are no reviews for SLC36A4 Antibody (NBP1-81931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC36A4 Antibody (NBP1-81931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC36A4 Antibody (NBP1-81931)

Discover related pathways, diseases and genes to SLC36A4 Antibody (NBP1-81931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC36A4 Antibody (NBP1-81931)

Discover more about diseases related to SLC36A4 Antibody (NBP1-81931).
 

Pathways for SLC36A4 Antibody (NBP1-81931)

View related products by pathway.

Blogs on SLC36A4

There are no specific blogs for SLC36A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC36A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC36A4