SLC35B2 Recombinant Protein Antigen

Images

 
There are currently no images for SLC35B2 Protein (NBP1-80641PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC35B2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC35B2.

Source: E.coli

Amino Acid Sequence: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC35B2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-80641.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SLC35B2 Recombinant Protein Antigen

  • adenosine 3'-phospho 5'-phosphosulfate transporter 1
  • PAPS transporter 1
  • PAPST13'-phosphoadenosine 5'-phosphosulfate transporter
  • Putative MAPK-activating protein PM15
  • Putative NF-kappa-B-activating protein 48
  • SLL
  • solute carrier family 35 member B2 variant 2
  • Solute carrier family 35 member B2
  • solute carrier family 35, member B2
  • UGTrel4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-37943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF123
Species: Hu
Applications: WB, Block, ICC
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2806
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29948
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-49892
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for SLC35B2 Protein (NBP1-80641PEP) (0)

There are no publications for SLC35B2 Protein (NBP1-80641PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35B2 Protein (NBP1-80641PEP) (0)

There are no reviews for SLC35B2 Protein (NBP1-80641PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SLC35B2 Protein (NBP1-80641PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC35B2 Products

Bioinformatics Tool for SLC35B2 Protein (NBP1-80641PEP)

Discover related pathways, diseases and genes to SLC35B2 Protein (NBP1-80641PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35B2 Protein (NBP1-80641PEP)

Discover more about diseases related to SLC35B2 Protein (NBP1-80641PEP).
 

Pathways for SLC35B2 Protein (NBP1-80641PEP)

View related products by pathway.

PTMs for SLC35B2 Protein (NBP1-80641PEP)

Learn more about PTMs related to SLC35B2 Protein (NBP1-80641PEP).

Blogs on SLC35B2

There are no specific blogs for SLC35B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
SLC35B2 Antibody
NBP1-80641

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC35B2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35B2