Recombinant Human SLC30A6 Protein

Images

 
SDS-Page: Recombinant Human SLC30A6 Protein [H00055676-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human SLC30A6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-216 of Human SLC30A6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLC30A6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Theoretical MW
49.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC30A6 Protein

  • MGC45055
  • MST103
  • MSTP103
  • solute carrier family 30 (zinc transporter), member 6
  • Solute carrier family 30 member 6
  • zinc transporter 6
  • znT-6
  • ZNT6FLJ31101

Background

SLC30A6( AAH32525, 1 a.a. - 217 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86824
Species: Hu
Applications: IHC, IHC-P
NBP2-66083
Species: Hu
NBP1-80578
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31825
Species: Hu
Applications: IHC, IHC-P
NBP2-06015
Species: Hu
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-76503
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KO
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-88261
Species: Hu
Applications: IHC, IHC-P
AF7318
Species: Hu
Applications: IHC
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-22683
Species: Hu
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055676-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for SLC30A6 Recombinant Protein (H00055676-P01) (0)

There are no publications for SLC30A6 Recombinant Protein (H00055676-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC30A6 Recombinant Protein (H00055676-P01) (0)

There are no reviews for SLC30A6 Recombinant Protein (H00055676-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC30A6 Recombinant Protein (H00055676-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SLC30A6 Recombinant Protein (H00055676-P01)

Discover related pathways, diseases and genes to SLC30A6 Recombinant Protein (H00055676-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC30A6 Recombinant Protein (H00055676-P01)

Discover more about diseases related to SLC30A6 Recombinant Protein (H00055676-P01).
 

Pathways for SLC30A6 Recombinant Protein (H00055676-P01)

View related products by pathway.

Blogs on SLC30A6

There are no specific blogs for SLC30A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TGN46 Antibody
NBP1-49643
SLC30A6 Antibody
NBP2-31673

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC30A6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC30A6