Recombinant Human SLC26A6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC26A6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 666-738 of Human SLC26A6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL

Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC26A6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC26A6 Protein

  • anion transporter 1
  • DKFZp586E1422
  • pendrin L1
  • pendrin-L1
  • Pendrin-like protein 1
  • solute carrier family 26 member 6
  • solute carrier family 26, member 6
  • sulfate anion transporter

Background

SLC26A6 - solute carrier family 26, member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
H00001836-M04
Species: Hu
Applications: WB, ELISA
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60965
Species: Hu, Mu
Applications: WB, ICC/IF
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP2-13340
Species: Hu
Applications: IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
H00065010-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLC26A6 Partial Recombinant Protein (H00065010-Q01) (0)

There are no publications for SLC26A6 Partial Recombinant Protein (H00065010-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC26A6 Partial Recombinant Protein (H00065010-Q01) (0)

There are no reviews for SLC26A6 Partial Recombinant Protein (H00065010-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC26A6 Partial Recombinant Protein (H00065010-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC26A6 Products

Bioinformatics Tool for SLC26A6 Partial Recombinant Protein (H00065010-Q01)

Discover related pathways, diseases and genes to SLC26A6 Partial Recombinant Protein (H00065010-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A6 Partial Recombinant Protein (H00065010-Q01)

Discover more about diseases related to SLC26A6 Partial Recombinant Protein (H00065010-Q01).
 

Pathways for SLC26A6 Partial Recombinant Protein (H00065010-Q01)

View related products by pathway.

PTMs for SLC26A6 Partial Recombinant Protein (H00065010-Q01)

Learn more about PTMs related to SLC26A6 Partial Recombinant Protein (H00065010-Q01).

Blogs on SLC26A6

There are no specific blogs for SLC26A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SLC26A6 Antibody
NBP2-47273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC26A6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A6