Recombinant Human SLC25A23 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human SLC25A23 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-74 of Human SLC25A23
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: RGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRY

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: SLC25A23
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 33.77 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A23 GST (N-Term) Protein

• APC2FLJ30339
• calcium-binding mitochondrial carrier protein SCaMC-3
• MCSC2
• MGC2615
• Mitochondrial ATP-Mg/Pi carrier protein 2
• Mitochondrial Ca(2+)-dependent solute carrier protein 2
• mitochondrial Ca2+-dependent solute carrier protein 2
• SCAMC3
• SCaMC-3
• short calcium-binding mitochondrial carrier 3
• Small calcium-binding mitochondrial carrier protein 3
• solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23
• Solute carrier family 25 member 23

Background

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites,nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediatesthe transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into orfrom the mitochondria

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A23