SLC25A17 Antibody

Immunocytochemistry/Immunofluorescence: SLC25A17 Antibody [NBP2-56442] - Staining of human cell line U-2 OS shows localization to peroxisomes.

Product Discontinued

SLC25A17 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYK
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC25A17 Antibody

• 34 kDa peroxisomal membrane protein
• peroxisomal membrane protein (34kD)
• peroxisomal membrane protein PMP34
• PMP34
• Solute Carrier Family 25 (Mitochondrial Carrier; Peroxisomal MembraneProtein, 34kD), Member 17
• Solute Carrier Family 25 Member 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A17