SLC22A23 Antibody

Images

 
Western Blot: SLC22A23 Antibody [NBP2-83539] - WB Suggested Anti-SLC22A23 Antibody Titration: 1.0ug/ml. Positive Control: Jurkat cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A23 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC22A23. Peptide sequence: VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A23
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for SLC22A23 Antibody

  • solute carrier family 22, member 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-52963
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
NBP2-31914
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89295
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30392
Species: Hu
Applications: IHC, IHC-P
NBP2-32395
Species: Hu
Applications: IHC, IHC-P
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF5486
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
NBP2-01360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84104
Species: Hu
Applications: IHC, IHC-P
NBP2-82023
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4856
Species: Hu, Mu, Rt
Applications: IHC, WB
H00283238-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-93466
Species: Hu
Applications: IHC, IHC-P
NBP2-19388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-10204
Species: Mu
Applications: WB
NBP2-38151
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83539
Species: Hu
Applications: WB

Publications for SLC22A23 Antibody (NBP2-83539) (0)

There are no publications for SLC22A23 Antibody (NBP2-83539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A23 Antibody (NBP2-83539) (0)

There are no reviews for SLC22A23 Antibody (NBP2-83539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A23 Antibody (NBP2-83539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A23 Products

Bioinformatics Tool for SLC22A23 Antibody (NBP2-83539)

Discover related pathways, diseases and genes to SLC22A23 Antibody (NBP2-83539). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A23 Antibody (NBP2-83539)

Discover more about diseases related to SLC22A23 Antibody (NBP2-83539).
 

Pathways for SLC22A23 Antibody (NBP2-83539)

View related products by pathway.

Blogs on SLC22A23

There are no specific blogs for SLC22A23, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A23