Recombinant Human Slap Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Slap Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-276 of Human SLA full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED

Protein/Peptide Type
Recombinant Protein
Gene
SLA

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Slap Protein

  • hSLAP
  • SLA1
  • SLAP
  • SLAP1
  • SLAP-1
  • Src-like-adapter protein 1
  • Src-like-adapter
  • Src-like-adaptor

Background

SLA( AAH07042, 1 a.a. - 277 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92334
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB3857
Species: Hu
Applications: WB
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for Slap Recombinant Protein (H00006503-P01) (0)

There are no publications for Slap Recombinant Protein (H00006503-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slap Recombinant Protein (H00006503-P01) (0)

There are no reviews for Slap Recombinant Protein (H00006503-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Slap Recombinant Protein (H00006503-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Slap Products

Bioinformatics Tool for Slap Recombinant Protein (H00006503-P01)

Discover related pathways, diseases and genes to Slap Recombinant Protein (H00006503-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slap Recombinant Protein (H00006503-P01)

Discover more about diseases related to Slap Recombinant Protein (H00006503-P01).
 

Pathways for Slap Recombinant Protein (H00006503-P01)

View related products by pathway.

PTMs for Slap Recombinant Protein (H00006503-P01)

Learn more about PTMs related to Slap Recombinant Protein (H00006503-P01).

Blogs on Slap

There are no specific blogs for Slap, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Slap Antibody
NBP2-24696
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Slap Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLA