Slap Antibody (2A1)

Images

 
There are currently no images for Slap Antibody (H00006503-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Slap Antibody (2A1) Summary

Immunogen
SLA (AAH07042, 1 a.a. - 276 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED
Specificity
Src-like-adaptor
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Slap Antibody (2A1)

  • hSLAP
  • SLA1
  • SLAP
  • SLAP1
  • SLAP-1
  • Src-like-adapter protein 1
  • Src-like-adapter
  • Src-like-adaptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92334
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB3857
Species: Hu
Applications: WB
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for Slap Antibody (H00006503-M01) (0)

There are no publications for Slap Antibody (H00006503-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slap Antibody (H00006503-M01) (0)

There are no reviews for Slap Antibody (H00006503-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Slap Antibody (H00006503-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Slap Products

Bioinformatics Tool for Slap Antibody (H00006503-M01)

Discover related pathways, diseases and genes to Slap Antibody (H00006503-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slap Antibody (H00006503-M01)

Discover more about diseases related to Slap Antibody (H00006503-M01).
 

Pathways for Slap Antibody (H00006503-M01)

View related products by pathway.

PTMs for Slap Antibody (H00006503-M01)

Learn more about PTMs related to Slap Antibody (H00006503-M01).

Blogs on Slap

There are no specific blogs for Slap, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Slap Antibody (2A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLA
Entrez
OMIM
Uniprot