Recombinant Human Skp2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Skp2 Protein [H00006502-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PEP-ELISA, AP

Order Details

Recombinant Human Skp2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-424 of Human SKP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SKP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Peptide ELISA
  • Protein Array
  • Western Blot
Application Notes
Peptide ELISA was reported in scientific literature.
Theoretical MW
74.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00006502-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Skp2 GST (N-Term) Protein

  • CDK2/cyclin A-associated protein p45
  • cyclin A/CDK2-associated protein p45
  • Cyclin-A/CDK2-associated protein p45
  • FBL1
  • F-box protein Skp2
  • F-box/LRR-repeat protein 1
  • FBXL1
  • FBXL1MGC1366
  • FLB1
  • p45skp2
  • Skp2
  • S-phase kinase-associated protein 2 (p45)
  • S-phase kinase-associated protein 2

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates 2 transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1555
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00003429-A01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB7557
Species: Hu
Applications: IHC, WB
255-SC/CF
Species: Hu
Applications: BA
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00001163-B01P
Species: Hu, Rt
Applications: WB
NBP3-16092
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-82580
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB

Publications for Skp2 Recombinant Protein (H00006502-P01)(1)

We have publications tested in 1 application: PEP-ELISA.


Filter By Application
PEP-ELISA
(1)
All Applications
Filter By Species
All Species

Reviews for Skp2 Recombinant Protein (H00006502-P01) (0)

There are no reviews for Skp2 Recombinant Protein (H00006502-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Skp2 Recombinant Protein (H00006502-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Skp2 Products

Bioinformatics Tool for Skp2 Recombinant Protein (H00006502-P01)

Discover related pathways, diseases and genes to Skp2 Recombinant Protein (H00006502-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Skp2 Recombinant Protein (H00006502-P01)

Discover more about diseases related to Skp2 Recombinant Protein (H00006502-P01).
 

Pathways for Skp2 Recombinant Protein (H00006502-P01)

View related products by pathway.

PTMs for Skp2 Recombinant Protein (H00006502-P01)

Learn more about PTMs related to Skp2 Recombinant Protein (H00006502-P01).
 

Research Areas for Skp2 Recombinant Protein (H00006502-P01)

Find related products by research area.

Blogs on Skp2.

Epigenetic Control of Autophagy
By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Skp2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SKP2