Skp2 Recombinant Protein Antigen

Images

 
There are currently no images for Skp2 Recombinant Protein Antigen (NBP2-56192PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Skp2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Skp2.

Source: E. coli

Amino Acid Sequence: SLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SKP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56192. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Skp2 Recombinant Protein Antigen

  • CDK2/cyclin A-associated protein p45
  • cyclin A/CDK2-associated protein p45
  • Cyclin-A/CDK2-associated protein p45
  • FBL1
  • F-box protein Skp2
  • F-box/LRR-repeat protein 1
  • FBXL1
  • FBXL1MGC1366
  • FLB1
  • p45skp2
  • Skp2
  • S-phase kinase-associated protein 2 (p45)
  • S-phase kinase-associated protein 2

Background

The critical role that the family of regulatory proteins known as cyclins plays in eukaryotic cell cycle regulation is well established. The best characterized cyclin complex is the mitotic cyclin B/Cdc2 p34 kinase, the active component of MPF (maturation promoting factor). Cyclin A accumulates prior to cyclin B in the cell cycle, appears to be involved in control of S phase and has been shown to associate with cyclin dependent kinase 2 (Cdk2). In addition, cyclin A has been implicated in cell transformation and is found in complexes with E1A, transcription factors DP-1 and E2F, and retinoblastoma protein p110. Two cyclin A-Cdk2 complex binding proteins, Skp1 p19 and Skp2 p45, have been described. Although the Skps (S phase kinase-associated proteins) associate with the active cyclin A-Cdk2 complex, they do not exhibit any regulatory effects on the complex. Abolition of Skp2 p45 function by either microinjection of anti-p45 antibodies or addition of antisense oligonucleotides prevents entry into S phase of both normal and transformed cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3994
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-26876
Species: Hu
Applications: IHC,  IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB7557
Species: Hu
Applications: IHC, WB
255-SC
Species: Hu
Applications: BA
AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00001163-B01P
Species: Hu, Rt
Applications: WB
NBP3-16092
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82580
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB

Publications for Skp2 Recombinant Protein Antigen (NBP2-56192PEP) (0)

There are no publications for Skp2 Recombinant Protein Antigen (NBP2-56192PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Skp2 Recombinant Protein Antigen (NBP2-56192PEP) (0)

There are no reviews for Skp2 Recombinant Protein Antigen (NBP2-56192PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Skp2 Recombinant Protein Antigen (NBP2-56192PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Skp2 Products

Research Areas for Skp2 Recombinant Protein Antigen (NBP2-56192PEP)

Find related products by research area.

Blogs on Skp2.

Epigenetic Control of Autophagy
By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Skp2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SKP2