Skp2 Antibody

Western Blot: Skp2 Antibody [H00006502-B01P] - Analysis of SKP2 expression in transfected 293T cell line by SKP2 polyclonal antibody. Lane 1: SKP2 transfected lysate(47.80 KDa). Lane 2: Non-transfected lysate.

Proximity Ligation Assay: Skp2 Antibody [H00006502-B01P] - Analysis of protein-protein interactions between CDKN1A and SKP2. HeLa cells were stained with anti-CDKN1A rabbit purified polyclonal 1:1200 and anti-SKP2 mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein in

Product Discontinued

Skp2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SKP2 (NP_005974.2, 1 a.a. - 424 a.a.) full-length human protein. MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SKP2
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: It has been used for WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Skp2 Antibody

• CDK2/cyclin A-associated protein p45
• cyclin A/CDK2-associated protein p45
• Cyclin-A/CDK2-associated protein p45
• FBL1
• F-box protein Skp2
• F-box/LRR-repeat protein 1
• FBXL1
• FBXL1MGC1366
• FLB1
• p45skp2
• Skp2
• S-phase kinase-associated protein 2 (p45)
• S-phase kinase-associated protein 2

Background

The critical role that the family of regulatory proteins known as cyclins plays in eukaryotic cell cycle regulation is well established. The best characterized cyclin complex is the mitotic cyclin B/Cdc2 p34 kinase, the active component of MPF (maturation promoting factor). Cyclin A accumulates prior to cyclin B in the cell cycle, appears to be involved in control of S phase and has been shown to associate with cyclin dependent kinase 2 (Cdk2). In addition, cyclin A has been implicated in cell transformation and is found in complexes with E1A, transcription factors DP-1 and E2F, and retinoblastoma protein p110. Two cyclin A-Cdk2 complex binding proteins, Skp1 p19 and Skp2 p45, have been described. Although the Skps (S phase kinase-associated proteins) associate with the active cyclin A-Cdk2 complex, they do not exhibit any regulatory effects on the complex. Abolition of Skp2 p45 function by either microinjection of anti-p45 antibodies or addition of antisense oligonucleotides prevents entry into S phase of both normal and transformed cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKP2
• Uniprot:
  • NP_005974.2(Human)