SKA1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SKA1 Antibody [NBP1-92391] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (microtubules). Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SKA1 Antibody [NBP1-92391] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: SKA1 Antibody [NBP1-92391] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SKA1 Antibody [NBP1-92391] - Staining of human rectum shows moderate cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: SKA1 Antibody [NBP1-92391] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Discontinued

SKA1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SKA1 Antibody - BSA Free

• C18orf24
• chromosome 18 open reading frame 24
• MGC10200
• spindle and kinetochore associated complex subunit 1
• spindle and kinetochore-associated protein 1
• spindle and KT (kinetochore) associated 1

Background

SKA1 is a component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essentialfor proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolarattachment on spindle microtubu

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKA1