SKA1 Antibody

Images

 
Western Blot: SKA1 Antibody [NBP1-92391] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: SKA1 Antibody [NBP1-92391] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: SKA1 Antibody [NBP1-92391] - Staining of human small intestine shows distinct cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM
Specificity
Specificity of human SKA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SKA1 Protein (NBP1-92391PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKA1 Antibody

  • C18orf24
  • chromosome 18 open reading frame 24
  • MGC10200
  • spindle and kinetochore associated complex subunit 1
  • spindle and kinetochore-associated protein 1
  • spindle and KT (kinetochore) associated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32443
Species: Hu
Applications: IHC, IHC-P
NBP1-88398
Species: Hu
Applications: IHC, IHC-P
8090-ZN
Species: Hu
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
2629-FG/CF
Species: Mu
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NB100-2586
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB110-40681
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF4185
Species: Hu
Applications: ICC
NBP1-88302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-563
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-77086
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SKA1 Antibody (NBP1-92391) (0)

There are no publications for SKA1 Antibody (NBP1-92391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKA1 Antibody (NBP1-92391) (0)

There are no reviews for SKA1 Antibody (NBP1-92391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SKA1 Antibody (NBP1-92391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SKA1 Antibody (NBP1-92391)

Discover related pathways, diseases and genes to SKA1 Antibody (NBP1-92391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKA1 Antibody (NBP1-92391)

Discover more about diseases related to SKA1 Antibody (NBP1-92391).
 

Pathways for SKA1 Antibody (NBP1-92391)

View related products by pathway.

PTMs for SKA1 Antibody (NBP1-92391)

Learn more about PTMs related to SKA1 Antibody (NBP1-92391).

Blogs on SKA1

There are no specific blogs for SKA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SKA1