SIRPB2 Antibody - BSA Free

Western Blot: SIRPB2 Antibody [NBP3-09531] - Western blot analysis of SIRPB2 in Fetal Heart as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SIRPB2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SIRPB2 (NP_001128308). Peptide sequence GGISHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQ
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIRPB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SIRPB2 Antibody - BSA Free

• dJ776F14.2
• Protein Tyrosine Phosphatase Non-Receptor Type Substrate 1-Like 3
• Protein Tyrosine Phosphatase Non-Receptor Type Substrate Protein
• Protein Tyrosine Phosphatase, Non-Receptor Type 1-Like
• Protein Tyrosine Phosphatase, Non-Receptor Type Substrate 1-Like 3
• PTPN1L
• PTPNS1L3
• Signal-Regulatory Protein Beta 2
• Signal-Regulatory Protein Beta-2
• SIRP beta 2
• SIRP-beta-2
• SIRPG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIRPB2