SIPA1 Recombinant Protein Antigen

Images

 
There are currently no images for SIPA1 Protein (NBP2-32620PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SIPA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIPA1.

Source: E.coli

Amino Acid Sequence: SPSGSEDKGNPAPELRASFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESM

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIPA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32620.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SIPA1 Recombinant Protein Antigen

  • GTPase-activating protein Spa-1
  • MGC102688
  • MGC17037
  • p130 SPA-1
  • signal-induced proliferation-associated 1
  • signal-induced proliferation-associated protein 1
  • sipa-1
  • SPA1signal-induced proliferation-associated gene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC-P
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
NBP2-32620PEP
Species: Hu
Applications: AC

Publications for SIPA1 Protein (NBP2-32620PEP) (0)

There are no publications for SIPA1 Protein (NBP2-32620PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIPA1 Protein (NBP2-32620PEP) (0)

There are no reviews for SIPA1 Protein (NBP2-32620PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SIPA1 Protein (NBP2-32620PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIPA1 Products

Bioinformatics Tool for SIPA1 Protein (NBP2-32620PEP)

Discover related pathways, diseases and genes to SIPA1 Protein (NBP2-32620PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIPA1 Protein (NBP2-32620PEP)

Discover more about diseases related to SIPA1 Protein (NBP2-32620PEP).
 

Pathways for SIPA1 Protein (NBP2-32620PEP)

View related products by pathway.

PTMs for SIPA1 Protein (NBP2-32620PEP)

Learn more about PTMs related to SIPA1 Protein (NBP2-32620PEP).
 

Research Areas for SIPA1 Protein (NBP2-32620PEP)

Find related products by research area.

Blogs on SIPA1

There are no specific blogs for SIPA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SIPA1 Antibody
NBP2-20369
SIPA1 Antibody
NBP2-20369
SIPA1 Antibody
NBP2-20369
BRD4 Antibody
NB100-56487
BRD4 Antibody
NB100-56487
BRD4 Antibody
NB100-56487

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIPA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SIPA1