Recombinant Human SIM1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SIM1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 657-766 of Human SIM1

Source: Wheat Germ

Amino Acid Sequence: RISSPNSDRISKSSLILAKDYLHSDISPHQTAGDHPTVSPNCFGSHRQYFDKHAYTLTGYALEHLYDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SIM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SIM1 Protein

  • BHLHE14
  • bHLHe14single-minded homolog 1
  • Class E basic helix-loop-helix protein 14
  • single-minded (Drosophila) homolog 1
  • single-minded homolog 1 (Drosophila)

Background

SIM1 - single-minded homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-88623
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-76346
Species: Mu, Rt
Applications: Flow, PEP-ELISA, IF
NBP2-19642
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21585
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB100-128
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P
AF5805
Species: Hu
Applications: WB
NBP2-76346
Species: Mu, Rt
Applications: Flow, PEP-ELISA, IF
NBP2-57757
Species: Hu
Applications: IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
H00006492-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SIM1 Partial Recombinant Protein (H00006492-Q01) (0)

There are no publications for SIM1 Partial Recombinant Protein (H00006492-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIM1 Partial Recombinant Protein (H00006492-Q01) (0)

There are no reviews for SIM1 Partial Recombinant Protein (H00006492-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIM1 Partial Recombinant Protein (H00006492-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SIM1 Products

Array H00006492-Q01

Bioinformatics Tool for SIM1 Partial Recombinant Protein (H00006492-Q01)

Discover related pathways, diseases and genes to SIM1 Partial Recombinant Protein (H00006492-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIM1 Partial Recombinant Protein (H00006492-Q01)

Discover more about diseases related to SIM1 Partial Recombinant Protein (H00006492-Q01).
 

Pathways for SIM1 Partial Recombinant Protein (H00006492-Q01)

View related products by pathway.

PTMs for SIM1 Partial Recombinant Protein (H00006492-Q01)

Learn more about PTMs related to SIM1 Partial Recombinant Protein (H00006492-Q01).
 

Research Areas for SIM1 Partial Recombinant Protein (H00006492-Q01)

Find related products by research area.

Blogs on SIM1

There are no specific blogs for SIM1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SIM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIM1
COVID-19 update