SIAH3 Recombinant Protein Antigen

Images

 
There are currently no images for SIAH3 Protein (NBP2-32555PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SIAH3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIAH3.

Source: E.coli

Amino Acid Sequence: SFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIAH3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32555.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SIAH3 Recombinant Protein Antigen

  • Seven In Absentia Homolog 3 (Drosophila)
  • Seven In Absentia Homolog 3
  • Siah E3 Ubiquitin Protein Ligase Family Member 3
  • siah-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

23320002
Species: Hu
Applications: ELISA, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF4737
Species: Hu
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF6817
Species: Hu
Applications: WB
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB2476
Species: Hu
Applications: WB, IHC
44450002
Species: Hu
Applications: WB, ELISA
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84492
Species: Hu
Applications: IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-60414
Species: Hu
Applications: WB, IP
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32555PEP
Species: Hu
Applications: AC

Publications for SIAH3 Protein (NBP2-32555PEP) (0)

There are no publications for SIAH3 Protein (NBP2-32555PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIAH3 Protein (NBP2-32555PEP) (0)

There are no reviews for SIAH3 Protein (NBP2-32555PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SIAH3 Protein (NBP2-32555PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIAH3 Products

SIAH3 NBP2-32555PEP

Bioinformatics Tool for SIAH3 Protein (NBP2-32555PEP)

Discover related pathways, diseases and genes to SIAH3 Protein (NBP2-32555PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIAH3 Protein (NBP2-32555PEP)

Discover more about diseases related to SIAH3 Protein (NBP2-32555PEP).

Blogs on SIAH3

There are no specific blogs for SIAH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SIAH3 Antibody
NBP2-32555

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIAH3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SIAH3