Recombinant Human SIAE Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SIAE Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-523 of Human SIAE full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SIAE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SIAE Protein

  • AIS6
  • CSEC
  • CSE-C
  • cytosolic sialic acid 9-O-acetylesterase homolog
  • EC 3.1.1.53
  • H-Lse
  • LSE
  • MGC87009
  • sialate O-acetylesterase
  • sialic acid acetylesterase
  • Sialic acid-specific 9-O-acetylesterase
  • sialic acid-specific acetylesterase II
  • Ysg2 homolog (mouse)
  • YSG2

Background

Sialic acids are acidic 9-carbon sugars typically found at the nonreducing end of sugar chains. They are frequently modified by 9-O-acetylation, and this modification is removed by sialic acid acetylesterases. SIAE appears to encode both lysosomal and cytosolic sialic acid acetylesterase isoforms (LSE and CSE, respectively) (Takematsu et al., 1999 [PubMed 10464298]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-37458
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5657
Species: Hu
Applications: WB, IP, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
AF2009
Species: Hu
Applications: WB, IHC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF7895
Species: Hu
Applications: WB, IHC
NB110-89459
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00054414-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SIAE Recombinant Protein (H00054414-P01) (0)

There are no publications for SIAE Recombinant Protein (H00054414-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIAE Recombinant Protein (H00054414-P01) (0)

There are no reviews for SIAE Recombinant Protein (H00054414-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIAE Recombinant Protein (H00054414-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIAE Products

Bioinformatics Tool for SIAE Recombinant Protein (H00054414-P01)

Discover related pathways, diseases and genes to SIAE Recombinant Protein (H00054414-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIAE Recombinant Protein (H00054414-P01)

Discover more about diseases related to SIAE Recombinant Protein (H00054414-P01).
 

Pathways for SIAE Recombinant Protein (H00054414-P01)

View related products by pathway.

PTMs for SIAE Recombinant Protein (H00054414-P01)

Learn more about PTMs related to SIAE Recombinant Protein (H00054414-P01).

Blogs on SIAE

There are no specific blogs for SIAE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SIAE Antibody
NBP1-84371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SIAE Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIAE