SIAE Antibody

Western Blot: SIAE Antibody [H00054414-B01P] - Analysis of SIAE expression in human colon.

Western Blot: SIAE Antibody [H00054414-B01P] - Analysis of SIAE expression in transfected 293T cell line by SIAE polyclonal antibody. Lane1:SIAE transfected lysate(57.53 KDa). Lane2:Non-transfected lysate.

Product Discontinued

SIAE Antibody Summary

• Immunogen: SIAE (NP_733746.1, 1 a.a. - 523 a.a.) full-length human protein. MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK
• Specificity: SIAE - sialic acid acetylesterase,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SIAE
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Immunoprecipitation was reported in scientific literature.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SIAE Antibody

• AIS6
• CSEC
• CSE-C
• cytosolic sialic acid 9-O-acetylesterase homolog
• EC 3.1.1.53
• H-Lse
• LSE
• MGC87009
• sialate O-acetylesterase
• sialic acid acetylesterase
• Sialic acid-specific 9-O-acetylesterase
• sialic acid-specific acetylesterase II
• Ysg2 homolog (mouse)
• YSG2

Background

Sialic acids are acidic 9-carbon sugars typically found at the nonreducing end of sugar chains. They are frequently modified by 9-O-acetylation, and this modification is removed by sialic acid acetylesterases. SIAE appears to encode both lysosomal and cytosolic sialic acid acetylesterase isoforms (LSE and CSE, respectively) (Takematsu et al., 1999 [PubMed 10464298]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SIAE Antibody (H00054414-B01P)(6)

Publications using H00054414-B01P

• Yang G, Ju Y, Fu M et al. Cystathionine gamma-lyase/hydrogen sulfide system is essential for adipogenesis and fat mass accumulation in mice. Biochim Biophys Acta 2017-11-28 [PMID: 29191638]
• Bourque C, Zhang Y, Fu M et al. H2S protects lipopolysaccharide-induced inflammation by blocking NF?B transactivation in endothelial cells. Toxicol Appl Pharmacol 2017-11-08 [PMID: 29128401]
• Lin Y, Zeng H, Gao L et al. Hydrogen Sulfide Attenuates Atherosclerosis in a Partially Ligated Carotid Artery Mouse model via Regulating Angiotensin Converting Enzyme 2 Expression. Front Physiol 2017-10-10 [PMID: 29066981]
• Bouma HR, Strijkstra AM, Boerema AS, and Henning RH Induction of a Torpor-Like State by 5'-AMP Does Not Depend on H2S Production. PLoS One. 2015-08-21 [PMID: 26295351]
• d'Emmanuele di Villa Bianca R, Mitidieri E, Di Minno MN et al. Hydrogen sulphide pathway contributes to the enhanced human platelet aggregation in hyperhomocysteinemia. Proc Natl Acad Sci U S A. 2013-09-24 [PMID: 24019484] (WB, Human)
• Chellappa V, Taylor KN, Pedrick K et al. M89V Sialic Acid Acetyl Esterase (SIAE) and All Other Non-Synonymous Common Variants of This Gene Are Catalytically Normal PLoS One 2013-01-01 [PMID: 23308225] (IP, WB, Human)

Bioinformatics

• Gene Symbol: SIAE
• Entrez:
  • 54414(Human)
• Uniprot:
  • NP_733746.1(Human)