Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, PA, AP

Order Details

Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein Summary

Description
Recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1159 - 1258 of Human INPPL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
INPPL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Immunohistochemistry
  • Protein Array
  • Western Blot
Publications
Read Publication using H00003636-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein

  • EC 3.1.3
  • EC 3.1.3.n1
  • inositol polyphosphate phosphatase-like 1
  • Inositol polyphosphate phosphatase-like protein 1
  • INPPL1
  • INPPL-1
  • phosphatidylinositol-34,5-trisphosphate 5-phosphatase 2
  • Protein 51C
  • SH2 domain-containing inositol phosphatase 2
  • SH2 domain-containing inositol-5'-phosphatase 2
  • SHIP2
  • SHIP-2
  • SHIP251C protein

Background

INPPL1 - inositol polyphosphate phosphatase-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16226
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NBP2-67321
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33116
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
AF5129
Species: Hu
Applications: WB
H00003636-Q01
Species: Hu
Applications: WB, ELISA, IHC, PA, AP

Publications for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01)(1)


Reviews for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01) (0)

There are no reviews for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SHIP2/INPPL1 Products

Bioinformatics Tool for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01)

Discover related pathways, diseases and genes to SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01)

Discover more about diseases related to SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01).
 

Pathways for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01)

View related products by pathway.

PTMs for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01)

Learn more about PTMs related to SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01).
 

Research Areas for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01)

Find related products by research area.

Blogs on SHIP2/INPPL1

There are no specific blogs for SHIP2/INPPL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INPPL1