SHC1 Recombinant Protein Antigen

Images

 
There are currently no images for SHC1 Protein (NBP1-87361PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SHC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SHC1.

Source: E. coli

Amino Acid Sequence: PLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SHC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87361.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SHC1 Recombinant Protein Antigen

  • FLJ26504
  • p66
  • p66SHC
  • SH2 domain protein C1
  • SHC (Src homology 2 domain containing) transforming protein 1
  • SHC (Src homology 2 domain-containing) transforming protein 1
  • SHC
  • SHC1
  • SHCA
  • SHC-transforming protein 1
  • SHC-transforming protein 3
  • SHC-transforming protein A
  • Src homology 2 domain-containing-transforming protein C1

Background

Signaling adapter that couples activated growth factor receptors to signaling pathway. Isoform p46Shc andisoform p52Shc, once phosphorylated, couple activated receptor tyrosine kinases to Ras via the recruitment of theGRB2/SOS complex and are implicated in the cytoplasmic propagation of mitogenic signals. Isoform p46Shc and isoformp52Shc may thus function as initiators of the Ras signaling cascade in various non-neuronal systems. Isoform p66Shcdoes not mediate Ras activation, but is involved in signal transduction pathways that regulate the cellular responseto oxidative stress and life span. Isoform p66Shc acts as a downstream target of the tumor suppressor p53 and isindispensable for the ability of stress-activated p53 to induce elevation of intracellular oxidants, cytochrome crelease and apoptosis. The expression of isoform p66Shc has been correlated with life span

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-82001
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
236-EG
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
1544-IR
Species: Hu
Applications: Bind
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010714-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
291-G1
Species: Hu
Applications: BA
NBP2-67429
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB

Publications for SHC1 Protein (NBP1-87361PEP) (0)

There are no publications for SHC1 Protein (NBP1-87361PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHC1 Protein (NBP1-87361PEP) (0)

There are no reviews for SHC1 Protein (NBP1-87361PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SHC1 Protein (NBP1-87361PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SHC1 Products

Research Areas for SHC1 Protein (NBP1-87361PEP)

Find related products by research area.

Blogs on SHC1

There are no specific blogs for SHC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SHC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SHC1