Recombinant Human SH2D3A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SH2D3A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 460-575 of Human SH2D3A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFVRRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SH2D3A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SH2D3A Protein

  • Novel SH2-containing protein 1
  • NSP1SH2 domain-containing 3A
  • SH2 domain containing 3A
  • SH2 domain-containing protein 3A

Background

SH2D3A - SH2 domain containing 3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-87003
Species: Hu, Rt
Applications: WB, IP, PLA
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-517
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-82520
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87963
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97677
Species: Hu, Mu, Rt, Po, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57521
Species: Hu
Applications: ICC/IF
AF6567
Species: Hu, Mu
Applications: WB, IHC
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-81546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SH2D3A Partial Recombinant Protein (H00010045-Q01) (0)

There are no publications for SH2D3A Partial Recombinant Protein (H00010045-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH2D3A Partial Recombinant Protein (H00010045-Q01) (0)

There are no reviews for SH2D3A Partial Recombinant Protein (H00010045-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH2D3A Partial Recombinant Protein (H00010045-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH2D3A Products

Bioinformatics Tool for SH2D3A Partial Recombinant Protein (H00010045-Q01)

Discover related pathways, diseases and genes to SH2D3A Partial Recombinant Protein (H00010045-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH2D3A Partial Recombinant Protein (H00010045-Q01)

Discover more about diseases related to SH2D3A Partial Recombinant Protein (H00010045-Q01).
 

Pathways for SH2D3A Partial Recombinant Protein (H00010045-Q01)

View related products by pathway.

PTMs for SH2D3A Partial Recombinant Protein (H00010045-Q01)

Learn more about PTMs related to SH2D3A Partial Recombinant Protein (H00010045-Q01).

Blogs on SH2D3A

There are no specific blogs for SH2D3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SH2D3A Antibody
NBP1-82525

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SH2D3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SH2D3A