SGK3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SGK3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SGK3.

  Source: E. coli

  Amino Acid Sequence: DVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSY

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SGK3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80760.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SGK3 Recombinant Protein Antigen

• CISK
• DKFZp781N0293
• EC 2.7.11
• EC 2.7.11.1
• serine/threonine-protein kinase Sgk3
• serum/glucocorticoid regulated kinase 3
• serum/glucocorticoid regulated kinase family, member 3
• serum/glucocorticoid regulated kinase-like
• Serum/glucocorticoid-regulated kinase 3
• Serum/glucocorticoid-regulated kinase-like
• SGK2
• SGK3
• SGKLcytokine-independent survival kinase

Background

SGKL/SGK3, also known as CISK for cytokine-independent survival kinase, is a SGK type protein kinase. The protein contains a lipid-binding phox homology (PX) domain, which is required for targeting SGKL/SGK3 protein to the endosomal compartment. SGKL/SGK3 functions downstream of the phosphoinositide 3-kinase (PI3K) cascade and has been implicated in cell survival. The protein has been shown to be phosphorylated and activated by 3-phosphoinositide-dependent protein kinase 1 (PDK1), and to a lesser extent insulin-like growth factor-1, in vitro. Activated SGKL/SGK3 has been shown to phosphorylate glycogen synthase kinase 3 beta (GSK-3beta) in vitro. SGKL/SGK3 expression has been documented in many human tissues but was found to be most abundant in lung. ESTs have been isolated from human tissue libraries, including normal liver, breast and thyroid and cancerous spleen, ear and pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SGK3