SGK3 Recombinant Protein Antigen

Images

 
There are currently no images for SGK3 Protein (NBP1-80760PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SGK3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SGK3.

Source: E. coli

Amino Acid Sequence: DVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SGK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80760.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SGK3 Recombinant Protein Antigen

  • CISK
  • DKFZp781N0293
  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine-protein kinase Sgk3
  • serum/glucocorticoid regulated kinase 3
  • serum/glucocorticoid regulated kinase family, member 3
  • serum/glucocorticoid regulated kinase-like
  • Serum/glucocorticoid-regulated kinase 3
  • Serum/glucocorticoid-regulated kinase-like
  • SGK2
  • SGK3
  • SGKLcytokine-independent survival kinase

Background

SGKL/SGK3, also known as CISK for cytokine-independent survival kinase, is a SGK type protein kinase. The protein contains a lipid-binding phox homology (PX) domain, which is required for targeting SGKL/SGK3 protein to the endosomal compartment. SGKL/SGK3 functions downstream of the phosphoinositide 3-kinase (PI3K) cascade and has been implicated in cell survival. The protein has been shown to be phosphorylated and activated by 3-phosphoinositide-dependent protein kinase 1 (PDK1), and to a lesser extent insulin-like growth factor-1, in vitro. Activated SGKL/SGK3 has been shown to phosphorylate glycogen synthase kinase 3 beta (GSK-3beta) in vitro. SGKL/SGK3 expression has been documented in many human tissues but was found to be most abundant in lung. ESTs have been isolated from human tissue libraries, including normal liver, breast and thyroid and cancerous spleen, ear and pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3200
Species: Hu
Applications: IHC, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB864
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NB100-2383
Species: Hu
Applications: ICC/IF, WB
H00023327-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-82574
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PAGE
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DY1747
Species: Hu
Applications: ELISA
NBP2-62651
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
291-G1
Species: Hu
Applications: BA
AF23151
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB

Publications for SGK3 Protein (NBP1-80760PEP) (0)

There are no publications for SGK3 Protein (NBP1-80760PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGK3 Protein (NBP1-80760PEP) (0)

There are no reviews for SGK3 Protein (NBP1-80760PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SGK3 Protein (NBP1-80760PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SGK3 Products

Research Areas for SGK3 Protein (NBP1-80760PEP)

Find related products by research area.

Blogs on SGK3.

mTOR Signaling and the Tumor Microenvironment
By Yoskaly Lazo-Fernandez, PhD The mammalian target of rapamycin (mTOR) is a conserved serine/threonine kinase that, as a member of two distinct intracellular protein complexes, mTORC1 and mTORC2, regulates protein ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SGK3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK3