sFRP-3/FRZB Antibody (4F7) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
FRZB (NP_001454, 102 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY* |
| Specificity |
FRZB (4F7) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
FRZB |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for sFRP-3/FRZB Antibody (4F7)
Background
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interactionwith Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appearsto be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bonedevelopment
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: Bind
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: BA
Publications for sFRP-3/FRZB Antibody (H00002487-M01) (0)
There are no publications for sFRP-3/FRZB Antibody (H00002487-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for sFRP-3/FRZB Antibody (H00002487-M01) (0)
There are no reviews for sFRP-3/FRZB Antibody (H00002487-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for sFRP-3/FRZB Antibody (H00002487-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional sFRP-3/FRZB Products
Research Areas for sFRP-3/FRZB Antibody (H00002487-M01)
Find related products by research area.
|
Blogs on sFRP-3/FRZB