sFRP-3/FRZB Antibody (1H8)

Western Blot: sFRP-3/FRZB Antibody (1H8) [H00002487-M05] - Analysis of FRZB expression in transfected 293T cell line by FRZB monoclonal antibody (M05), clone 1H8. Lane 1: FRZB transfected lysatE (36.254 KDa). Lane 2: Non-transfected lysate.

Western Blot: sFRP-3/FRZB Antibody (1H8) [H00002487-M05] - FRZB monoclonal antibody (M05), clone 1H8 Western Blot analysis of FRZB expression in 293 ( Cat # L026V1 ).

Product Discontinued

sFRP-3/FRZB Antibody (1H8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FRZB (NP_001454, 102 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*
• Specificity: FRZB (1H8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FRZB
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for sFRP-3/FRZB Antibody (1H8)

• FIZ
• FREOS1
• Frezzled
• Fritz
• Frizzled-related protein 1
• frizzled-related protein
• FRP
• FRP-3
• FRZB
• Frzb1
• FRZB-1
• FRZB1sFRP-3
• FRZB-PEN
• FZRB
• hFIZ
• secreted frizzled-related protein 3
• sFRP3
• sFRP-3
• SFRP3frezzled
• SRFP3frizzled homolog-related

Background

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interactionwith Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appearsto be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bonedevelopment

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FRZB
• Entrez:
  • 2487(Human)
• OMIM:
  • 165720(Human)
• Uniprot:
  • NP_001454(Human)