sFRP-3/FRZB Antibody (1H8)

Images

 
Western Blot: sFRP-3/FRZB Antibody (1H8) [H00002487-M05] - FRZB monoclonal antibody (M05), clone 1H8 Western Blot analysis of FRZB expression in 293 ( Cat # L026V1 ).
Western Blot: sFRP-3/FRZB Antibody (1H8) [H00002487-M05] - Analysis of FRZB expression in transfected 293T cell line by FRZB monoclonal antibody (M05), clone 1H8. Lane 1: FRZB transfected lysatE (36.254 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

sFRP-3/FRZB Antibody (1H8) Summary

Immunogen
FRZB (NP_001454, 102 a.a. - 190 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*
Specificity
FRZB (1H8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FRZB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for sFRP-3/FRZB Antibody (1H8)

  • FIZ
  • FREOS1
  • Frezzled
  • Fritz
  • Frizzled-related protein 1
  • frizzled-related protein
  • FRP
  • FRP-3
  • FRZB
  • Frzb1
  • FRZB-1
  • FRZB1sFRP-3
  • FRZB-PEN
  • FZRB
  • hFIZ
  • secreted frizzled-related protein 3
  • sFRP3
  • sFRP-3
  • SFRP3frezzled
  • SRFP3frizzled homolog-related

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF1384
Species: Hu
Applications: WB, IHC, ICC
1169-FR/CF
Species: Mu
NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PEP-ELISA, ICC
AF1120
Species: Mu
Applications: WB, IHC
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
1827-SF/CF
Species: Hu

Publications for sFRP-3/FRZB Antibody (H00002487-M05) (0)

There are no publications for sFRP-3/FRZB Antibody (H00002487-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for sFRP-3/FRZB Antibody (H00002487-M05) (0)

There are no reviews for sFRP-3/FRZB Antibody (H00002487-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for sFRP-3/FRZB Antibody (H00002487-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional sFRP-3/FRZB Products

Bioinformatics Tool for sFRP-3/FRZB Antibody (H00002487-M05)

Discover related pathways, diseases and genes to sFRP-3/FRZB Antibody (H00002487-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for sFRP-3/FRZB Antibody (H00002487-M05)

Discover more about diseases related to sFRP-3/FRZB Antibody (H00002487-M05).
 

Pathways for sFRP-3/FRZB Antibody (H00002487-M05)

View related products by pathway.

PTMs for sFRP-3/FRZB Antibody (H00002487-M05)

Learn more about PTMs related to sFRP-3/FRZB Antibody (H00002487-M05).

Blogs on sFRP-3/FRZB

There are no specific blogs for sFRP-3/FRZB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our sFRP-3/FRZB Antibody (1H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol FRZB
Entrez
OMIM
Uniprot