Recombinant Human SFMBT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SFMBT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 121-230 of Human SFMBT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SFMBT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 60 mM NaCl, 50% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SFMBT1 Protein

  • DKFZp434L243
  • Renal ubiquitous protein 1
  • RU1scm-like with four MBT domains protein 1
  • Scm-like with four mbt domains 1
  • Scm-related gene containing four mbt domains
  • Scm-related gene product containing four mbt domains
  • SFMBT

Background

SFMBT1 - Scm-like with four mbt domains 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2806
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB600-488
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33470
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-07996
Species: Hu
NBP2-38230
Species: Hu
Applications: IHC, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051460-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SFMBT1 Partial Recombinant Protein (H00051460-Q01) (0)

There are no publications for SFMBT1 Partial Recombinant Protein (H00051460-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFMBT1 Partial Recombinant Protein (H00051460-Q01) (0)

There are no reviews for SFMBT1 Partial Recombinant Protein (H00051460-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SFMBT1 Partial Recombinant Protein (H00051460-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SFMBT1 Products

Bioinformatics Tool for SFMBT1 Partial Recombinant Protein (H00051460-Q01)

Discover related pathways, diseases and genes to SFMBT1 Partial Recombinant Protein (H00051460-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SFMBT1 Partial Recombinant Protein (H00051460-Q01)

Discover more about diseases related to SFMBT1 Partial Recombinant Protein (H00051460-Q01).
 

Pathways for SFMBT1 Partial Recombinant Protein (H00051460-Q01)

View related products by pathway.

Blogs on SFMBT1

There are no specific blogs for SFMBT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SFMBT1 Antibody
NBP2-48652

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SFMBT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SFMBT1