Recombinant Human SETDB2 Protein

Images

 
SDS-Page: Recombinant Human SETDB2 Protein [H00083852-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human SETDB2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_114121.1) for Human SETDB2

Source: Wheat Germ

Amino Acid Sequence: KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL 620-719

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SETDB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SETDB2 Protein

  • C13orf4
  • chromosome 13 open reading frame 4
  • chronic lymphocytic leukemia deletion region 8
  • Chronic lymphocytic leukemia deletion region gene 8 protein
  • CLLD8DKFZp761J1217
  • DKFZp586I0123
  • EC 2.1.1.43
  • histone-lysine N-methyltransferase SETDB2
  • KMT1FCLLL8
  • Lysine N-methyltransferase 1F
  • SET domain bifurcated 2
  • SET domain, bifurcated 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17086
Species: Hu, Mu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00051131-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24534
Species: Hu
Applications: WB, IHC-P
NBP2-01249
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-44315
Species: Hu, Mu, Rt, Ha, Mk
Applications: IHC-P
MAB5565
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20116
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-87021
Species: Hu
Applications: WB, IP
NBP2-20322
Species: Hu
Applications: WB, IP, ChIP, ICC
NBP1-90510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92443
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
H00055777-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00083852-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for SETDB2 Recombinant Protein (H00083852-Q01) (0)

There are no publications for SETDB2 Recombinant Protein (H00083852-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETDB2 Recombinant Protein (H00083852-Q01) (0)

There are no reviews for SETDB2 Recombinant Protein (H00083852-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SETDB2 Recombinant Protein (H00083852-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SETDB2 Recombinant Protein (H00083852-Q01)

Discover related pathways, diseases and genes to SETDB2 Recombinant Protein (H00083852-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SETDB2 Recombinant Protein (H00083852-Q01)

Discover more about diseases related to SETDB2 Recombinant Protein (H00083852-Q01).
 

Pathways for SETDB2 Recombinant Protein (H00083852-Q01)

View related products by pathway.

PTMs for SETDB2 Recombinant Protein (H00083852-Q01)

Learn more about PTMs related to SETDB2 Recombinant Protein (H00083852-Q01).

Blogs on SETDB2

There are no specific blogs for SETDB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SETDB2 Antibody
NB100-1137

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SETDB2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SETDB2