SETDB2 Antibody [HRP]

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: HRP

SETDB2 Antibody [HRP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 148-378 of human SETDB2 (NP_114121.2).
  
  Sequence:
  SGACLMKMPLNLKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEVVSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSCDCSEGCIDITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRVVQHGPQVRLQVFKTEQKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SETDB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Alternate Names for SETDB2 Antibody [HRP]

• C13orf4
• chromosome 13 open reading frame 4
• chronic lymphocytic leukemia deletion region 8
• Chronic lymphocytic leukemia deletion region gene 8 protein
• CLLD8DKFZp761J1217
• DKFZp586I0123
• EC 2.1.1.43
• histone-lysine N-methyltransferase SETDB2
• KMT1FCLLL8
• Lysine N-methyltransferase 1F
• SET domain bifurcated 2
• SET domain, bifurcated 2

Background

Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SETDB2