SERTAD3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SERTAD3 Antibody [NBP2-57666] - Staining of human cell line MCF7 shows localization to nucleoli.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SERTAD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SERTAD3 Antibody - BSA Free (NBP2-57666) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERTAD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SERTAD3 Recombinant Protein Antigen (NBP2-57666PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SERTAD3 Antibody - BSA Free

• RBT1Replication protein-binding trans-activator
• RPA-binding trans-activator
• SERTA domain containing 3
• SERTA domain-containing protein 3

Background

SERTAD3 is encoded by this gene was identified in a yeast two-hybrid assay employing the second subunit of human replication protein A as bait. It is localized to the nucleus and its expression is significantly higher in cancer cell lines compared to normal cell lines. This protein has also been shown to be a strong transcriptional co-activator. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERTAD3