Serpin A11 Antibody

Images

 
Western Blot: Serpin A11 Antibody [NBP2-84257] - Host: Rabbit. Target Name: SERPINA11. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Bv, Ca, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin A11 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human Serpin A11. Peptide sequence: TFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHR The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Equine (93%), Canine (100%), Bovine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINA11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin A11 Antibody

  • Antiproteinase-Like 2
  • antitrypsin), member 11
  • member 11
  • serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase
  • Serpin A11
  • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16197
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82723
Species: Hu
Applications: IHC, IHC-P
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-00103
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-32207
Species: Hu, Mu
Applications: WB
NBP1-77186
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IF
H00008614-M08
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
H00011065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP2-84257
Species: Hu, Bv, Ca, Eq
Applications: WB

Publications for Serpin A11 Antibody (NBP2-84257) (0)

There are no publications for Serpin A11 Antibody (NBP2-84257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin A11 Antibody (NBP2-84257) (0)

There are no reviews for Serpin A11 Antibody (NBP2-84257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin A11 Antibody (NBP2-84257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Serpin A11 Products

Array NBP2-84257

Bioinformatics Tool for Serpin A11 Antibody (NBP2-84257)

Discover related pathways, diseases and genes to Serpin A11 Antibody (NBP2-84257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin A11 Antibody (NBP2-84257)

Discover more about diseases related to Serpin A11 Antibody (NBP2-84257).

Blogs on Serpin A11

There are no specific blogs for Serpin A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin A11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINA11