SERCA1 ATPase Antibody (6F8)

Images

 
Sandwich ELISA: SERCA1 ATPase Antibody (6F8) [H00000487-M02] - Detection limit for recombinant GST tagged ATP2A1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SERCA1 ATPase Antibody (6F8) Summary

Immunogen
ATP2A1 (NP_775293, 522 a.a. - 612 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Specificity
ATP2A1 - ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP2A1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SERCA1 ATPase Antibody (6F8)

  • ATP2A
  • ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
  • Calcium pump 1
  • Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletalmuscle isoform
  • EC 3.6.3
  • Endoplasmic reticulum class 1/2 Ca(2+) ATPase
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 1
  • SERCA1EC 3.6.3.8
  • SR Ca(2+)-ATPase 1

Background

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
H00000489-M01
Species: Hu
Applications: WB, ELISA, IHC-P
MAB6967
Species: Hu
Applications: WB
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NBL1-16214
Species: Hu
NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-56991
Species: Hu
Applications: ICC/IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-90091
Species: Hu
Applications: IHC, IHC-P

Publications for SERCA1 ATPase Antibody (H00000487-M02) (0)

There are no publications for SERCA1 ATPase Antibody (H00000487-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERCA1 ATPase Antibody (H00000487-M02) (0)

There are no reviews for SERCA1 ATPase Antibody (H00000487-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERCA1 ATPase Antibody (H00000487-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SERCA1 ATPase Products

Bioinformatics Tool for SERCA1 ATPase Antibody (H00000487-M02)

Discover related pathways, diseases and genes to SERCA1 ATPase Antibody (H00000487-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERCA1 ATPase Antibody (H00000487-M02)

Discover more about diseases related to SERCA1 ATPase Antibody (H00000487-M02).
 

Pathways for SERCA1 ATPase Antibody (H00000487-M02)

View related products by pathway.

PTMs for SERCA1 ATPase Antibody (H00000487-M02)

Learn more about PTMs related to SERCA1 ATPase Antibody (H00000487-M02).

Blogs on SERCA1 ATPase.

Mending a Broken Heart: New SERCA2 Gene Therapy Fights Heart Disease
While many of the proteins on our antibody database are studied in relation to their expression in diseases; others become therapies in their own right. This is the case with SERCA2 (Sarcoplasmic reticulum Calcium-ATPase 2 pump), which recently hit th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERCA1 ATPase Antibody (6F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2A1
Entrez
OMIM
Uniprot