SERCA1 ATPase Antibody (5H8)

Images

 
Sandwich ELISA: SERCA1 ATPase Antibody (5H8) [H00000487-M04] - Detection limit for recombinant GST tagged ATP2A1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SERCA1 ATPase Antibody (5H8) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Specificity
ATP2A1 - ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP2A1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SERCA1 ATPase Antibody (5H8)

  • ATP2A
  • ATP2A1
  • ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
  • Calcium pump 1
  • Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletalmuscle isoform
  • EC 3.6.3
  • EC 7.2.2.10
  • Endoplasmic reticulum class 1/2 Ca(2+) ATPase
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 1
  • SERCA1 ATPase
  • SERCA1
  • SERCA1EC 3.6.3.8
  • SR Ca(2+)-ATPase 1

Background

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SERCA1 ATPase Antibody (H00000487-M04) (0)

There are no publications for SERCA1 ATPase Antibody (H00000487-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERCA1 ATPase Antibody (H00000487-M04) (0)

There are no reviews for SERCA1 ATPase Antibody (H00000487-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERCA1 ATPase Antibody (H00000487-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SERCA1 ATPase Products

Research Areas for SERCA1 ATPase Antibody (H00000487-M04)

Find related products by research area.

Blogs on SERCA1 ATPase.

Mending a Broken Heart: New SERCA2 Gene Therapy Fights Heart Disease
While many of the proteins on our antibody database are studied in relation to their expression in diseases; others become therapies in their own right. This is the case with SERCA2 (Sarcoplasmic reticulum Calcium-ATPase 2 pump), which recently hit th...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERCA1 ATPase Antibody (5H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2A1
Entrez
OMIM
Uniprot