Home » Septin-8 » Septin-8 Antibodies » Septin-8 Antibody

Septin-8 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Septin-8 Antibody [NBP2-76533] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Western Blot: Septin-8 Antibody [NBP2-76533] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Septin-8 Antibody [NBP2-76533] - Staining of human cell line A-431 shows localization to actin filaments. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Septin-8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NAFNRRKAAVEALQSQALHATSQQPLRKDKDKKNRSDIGAHQPGMSLSSSKVMMTKASVEPLNCSSWWPAIQCCSCLVRDATWREGFL
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPTIN8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Septin-8 Antibody

  • KIAA0202SEP2
  • septin 8
  • septin-8

Background

SEPT8 is a member of the highly conserved septin family. Septins are 40- to 60-kD GTPases that assemble as filamentous scaffolds. They are involved in the organization of submembranous structures, in neuronal polarity, and in vesicle trafficking (Blaser et al., 2003 (PubMed 12909369)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Septin-3 Antibody
NB100-1023
Western Blot: Septin-3 Antibody [NB100-1023] - NB100-1023 (0.5ug/ml) staining of Human Cerebellum (A), (0.1ug/ml) Mouse (B) and (0.03ug/ml) Rat (C) Brain lysate (35ug protein in RIPA buffer).. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Septin-3 Antibody [NB100-1023] - staining of paraffin embedded Human Cerebellum. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: Septin-3 Antibody [NB100-1023] - staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Plexin B1 Antibody
[Unconjugated]
AF3749
Plexin B1 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC, WB
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Septin-1 Antibody
(1F12)
H00001731-M03
Western Blot: Septin-1 Antibody (1F12) [H00001731-M03] - Analysis of SEPT1 expression in transfected 293T cell line by SEPT1 monoclonal antibody (M03), clone 1F12. Lane 1: SEPT1 transfected lysatE (42 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Septin-1 Antibody (1F12) [H00001731-M03] - Analysis of monoclonal antibody to SEPT1 on HeLa cell. Antibody concentration 10 ug/ml
Immunoprecipitation: Septin-1 Antibody (1F12) [H00001731-M03] - Analysis of SEPT1 transfected lysate using anti-SEPT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SEPT1 rabbit polyclonal antibody.
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
PDE5A Antibody
NBP1-86139
Immunohistochemistry-Paraffin: PDE5A Antibody [NBP1-86139] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PDE5A Antibody [NBP1-86139] - Staining of human prostate shows weak to moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: PDE5A Antibody [NBP1-86139] - Staining of human duodenum shows weak to moderate cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Xrn1 Antibody
NB500-191
Western Blot: Xrn1 Antibody [NB500-191] - Detection of human and mouse XRN1 by western blot. Samples:Whole cell lysate (15 ug) from GaMG, HEK293T, RKO, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-XRN1 antibody NB500-191 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunoprecipitation: Xrn1 Antibody [NB500-191] - Detection of human XRN1 by western blot of immunoprecipitates. Samples:Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-XRN1 antibody NB500-191 (lot NB500-191-4) used for IP at 6 ug per reaction. XRN1 was also immunoprecipitated by a previous lot of this antibody (lot NB500-191-3). For blotting immunoprecipitated XRN1, NB500-191 was used at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
(7 Publications)
Species: Hu, Mu
Applications: IP, WB
Septin-6 Antibody
NBP1-89626
Western Blot: Septin-6 Antibody [NBP1-89626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Septin-6 Antibody [NBP1-89626] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: Septin-6 Antibody [NBP1-89626] - Staining of human lymph node shows cytoplasmic positivity in reaction center cells.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Septin-2 Antibody
NBP1-85212
Immunohistochemistry-Paraffin: Septin-2 Antibody [NBP1-85212] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
Immunocytochemistry/Immunofluorescence: Septin-2 Antibody [NBP1-85212] - Imaging of cultured rat corrtical astrocytes. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Septin-2 Antibody [NBP1-85212] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Septin-11 Antibody
NBP1-31717
Western Blot: Septin-11 Antibody [NBP1-31717] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Septin-11 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Septin-11 Antibody [NBP1-31717] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Septin-11 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: Septin-11 Antibody [NBP1-31717] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Septin-11 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Septin-10 Antibody
(2A12)
H00151011-M01
Immunocytochemistry/Immunofluorescence: Septin-10 Antibody (2A12) [H00151011-M01] - Analysis of monoclonal antibody to SEPT10 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Septin-10 Antibody (2A12) [H00151011-M01] - Detection limit for recombinant GST tagged SEPT10 is approximately 1ng/ml as a capture antibody.
Western Blot: Septin-10 Antibody (2A12) [H00151011-M01] - Analysis of SEPT10 expression in transfected 293T cell line by SEPT10 monoclonal antibody (M01), clone 2A12.Lane 1: SEPT10 transfected lysate(52.6 KDa).Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Septin-9 Antibody
NBP1-28711
Western Blot: Septin-9 Antibody [NBP1-28711] - Lane 1: marker. Lane 2: 10mg of HeLa whole cell lysate probed with NBP1-28711 antibody 1:1000 in PBST. Blot blocked with 5% milk in PBS with 0.1% tween 20 probed overnight at 4C with NBP1-28711 at 1:1000 washed 3X PBST incubated with anti rabbit HRP secondary antiboy, washed 3X PBST, developed with ECL prime kit GE healthcare. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Septin-9 Antibody [NBP1-28711] - HeLa cells fixed with PFA (4%, 20 min, RT) with anti septin 9 antibody NBP1-28711 at 1:1000. Left panel: Control localisation to sub nuclear filaments. Right panel: Cells treated with cytochalasin D to depolymerize F-actin. Note localization to ring like structures. Image from verified customer review.
Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP1-28711] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti- Septin 9 used at a dilution of 1:1,000 (1ug/ml). Detection: Red-fluorescent goat anti-rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight® 594 Conjugated used at a dilution of 1:100.
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Synaptophysin
Antibody
NB300-653
Immunohistochemistry-Frozen: Synaptophysin Antibody [NB300-653] - Feline retina. Synaptophysin (green), DAPI (blue). The image was capture by epifluorescent microscopy. Image from verified customer review.
Western Blot: Synaptophysin Antibody [NB300-653] - Approximate MW of Synaptophysin is 39kDa.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NB300-653] - Rat brain, 1:100 dilution.
(2 Reviews)
(9 Publications)
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
GNAQ Antibody
NBP1-72047
Immunohistochemistry-Paraffin: GNAQ Antibody [NBP1-72047] - Staining of paraffin embedded Human Kidney. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: GNAQ Antibody [NBP1-72047] - Staining of Mouse (A) and Rat (B) Testis lysates (35 ug protein in RIPA buffer). Antibody at 0.1 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
Western Blot: GNAQ Antibody [NBP1-72047] - Staining of Human Peripheral Blood Lymphocytes lysate (35 ug protein in RIPA buffer). Antibody at 0.1 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence
(1 Publication)
Species: Hu, Mu, Po, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
ARHGEF1 Antibody
NBP1-82843
Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Staining of human lymph node shows high expression.
Immunocytochemistry/Immunofluorescence: ARHGEF1 Antibody [NBP1-82843] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PFTK1 Antibody
NBP1-80920
Immunocytochemistry/Immunofluorescence: PFTK1 Antibody [NBP1-80920] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
VAMP-2 Antibody
NB300-595
Flow Cytometry: VAMP-2 Antibody [NB300-595] - Cells were fixed with 70% ethanol for 10 minutes, permeabilized with 0.25% Triton™ X-100 for 20 minutes, and blocked with 5% BSA for 30 minutes at room temperature.
Western Blot: VAMP-2 Antibody [NB300-595] - Analysis was performed on tissues (40 ug lysate) of Mouse Cerebellum (Lane 1), Mouse Brain (Lane 2) and Rat Brain (Lane 3).
Western Blot: VAMP-2 Antibody [NB300-595] - Analysis of rat brain extract.
(4 Publications)
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB

Publications for Septin-8 Antibody (NBP2-76533) (0)

There are no publications for Septin-8 Antibody (NBP2-76533).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-8 Antibody (NBP2-76533) (0)

There are no reviews for Septin-8 Antibody (NBP2-76533). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Septin-8 Antibody (NBP2-76533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Septin-8 Products

Bioinformatics Tool for Septin-8 Antibody (NBP2-76533)

Discover related pathways, diseases and genes to Septin-8 Antibody (NBP2-76533). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-8 Antibody (NBP2-76533)

Discover more about diseases related to Septin-8 Antibody (NBP2-76533).
 

Pathways for Septin-8 Antibody (NBP2-76533)

View related products by pathway.

Research Areas for Septin-8 Antibody (NBP2-76533)

Find related products by research area.

Blogs on Septin-8

There are no specific blogs for Septin-8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-8 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SEPTIN8