Septin-1 Recombinant Protein Antigen

Images

 
There are currently no images for Septin-1 Protein (NBP1-84251PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Septin-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding Septin - 1.

Source: E.coli

Amino Acid Sequence: EVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEPT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84251.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Septin-1 Recombinant Protein Antigen

  • DIFF6SEP1
  • differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase)
  • LARP
  • Peanut-like protein 3
  • PNUTL3MGC20394
  • septin 1
  • septin-1
  • Serologically defined breast cancer antigen NY-BR-24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89626
Species: Hu
Applications: WB, IHC, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-15116
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1023
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Septin-1 Protein (NBP1-84251PEP) (0)

There are no publications for Septin-1 Protein (NBP1-84251PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-1 Protein (NBP1-84251PEP) (0)

There are no reviews for Septin-1 Protein (NBP1-84251PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Septin-1 Protein (NBP1-84251PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Septin-1 Products

Bioinformatics Tool for Septin-1 Protein (NBP1-84251PEP)

Discover related pathways, diseases and genes to Septin-1 Protein (NBP1-84251PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-1 Protein (NBP1-84251PEP)

Discover more about diseases related to Septin-1 Protein (NBP1-84251PEP).
 

Pathways for Septin-1 Protein (NBP1-84251PEP)

View related products by pathway.

PTMs for Septin-1 Protein (NBP1-84251PEP)

Learn more about PTMs related to Septin-1 Protein (NBP1-84251PEP).
 

Research Areas for Septin-1 Protein (NBP1-84251PEP)

Find related products by research area.

Blogs on Septin-1

There are no specific blogs for Septin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Septin-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPT1