Recombinant Human SELK Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SELK Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 39-91 of Human SELK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGG

Protein/Peptide Type
Partial Recombinant Protein
Gene
SELK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SELK Protein

  • HSPC297
  • MGC17057
  • selenoprotein K
  • SelK

Background

SELK - selenoprotein K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051734-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-47485
Species: Hu
Applications: WB, IHC, IHC-P
H00083642-P01
Species: Hu
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-53795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58690
Species: Hu
Applications: ICC/IF
NBP1-90883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46439
Species: Hu
Applications: WB, IHC

Publications for SELK Partial Recombinant Protein (H00058515-Q01) (0)

There are no publications for SELK Partial Recombinant Protein (H00058515-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SELK Partial Recombinant Protein (H00058515-Q01) (0)

There are no reviews for SELK Partial Recombinant Protein (H00058515-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SELK Partial Recombinant Protein (H00058515-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SELK Products

Bioinformatics Tool for SELK Partial Recombinant Protein (H00058515-Q01)

Discover related pathways, diseases and genes to SELK Partial Recombinant Protein (H00058515-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SELK Partial Recombinant Protein (H00058515-Q01)

Discover more about diseases related to SELK Partial Recombinant Protein (H00058515-Q01).
 

Pathways for SELK Partial Recombinant Protein (H00058515-Q01)

View related products by pathway.

PTMs for SELK Partial Recombinant Protein (H00058515-Q01)

Learn more about PTMs related to SELK Partial Recombinant Protein (H00058515-Q01).

Blogs on SELK

There are no specific blogs for SELK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605
SELK Antibody
NBP1-86120

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SELK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SELK