SEH1L Antibody

Immunohistochemistry-Paraffin: SEH1L Antibody [NBP1-80773] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Discontinued

SEH1L Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQI
• Predicted Species: Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEH1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SEH1L Antibody

• nucleoporin SEH1
• Nup107-160 subcomplex subunit SEH1
• sec13 like protein
• SEC13LSEC13-like protein
• SEH1
• SEH1A
• SEH1B
• SEH1-like (S. cerevisiae)

Background

SEH1L is encoded by this gene is part of a nuclear pore complex, Nup107-160. This protein contains WD repeats and shares 34% amino acid identity with yeast Seh1 and 30% identity with yeast Sec13. All constituents of the Nup107-160 complex, including this protein, specifically localize to kinetochores in mitosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Transcript Variant: This variant (2) has an additonal segment in the 3' coding region, as compared to variant 1. The encoded isoform 2 has a shorter and distinct C-terminus, as compared to isoform 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEH1L
• Entrez:
  • 81929(Human)