SEH1L Antibody

Images

 
Immunohistochemistry-Paraffin: SEH1L Antibody [NBP1-80773] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEH1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEH1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEH1L Protein (NBP1-80773PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEH1L Antibody

  • nucleoporin SEH1
  • Nup107-160 subcomplex subunit SEH1
  • sec13 like protein
  • SEC13LSEC13-like protein
  • SEH1
  • SEH1A
  • SEH1B
  • SEH1-like (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NBP2-23718
Species: Hu, Bv, Eq, Pm
Applications: IHC-P
AF5976
Species: Hu
Applications: WB, ICC
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-86929
Species: Hu
Applications: IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, IP
NBP1-82537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP

Publications for SEH1L Antibody (NBP1-80773) (0)

There are no publications for SEH1L Antibody (NBP1-80773).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEH1L Antibody (NBP1-80773) (0)

There are no reviews for SEH1L Antibody (NBP1-80773). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SEH1L Antibody (NBP1-80773) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEH1L Products

Bioinformatics Tool for SEH1L Antibody (NBP1-80773)

Discover related pathways, diseases and genes to SEH1L Antibody (NBP1-80773). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEH1L Antibody (NBP1-80773)

Discover more about diseases related to SEH1L Antibody (NBP1-80773).

Blogs on SEH1L

There are no specific blogs for SEH1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEH1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEH1L