Secretin R Antibody (3H1)

Images

 
Western Blot: Secretin R Antibody (3H1) [H00006344-M01] - SCTR monoclonal antibody (M01), clone 3H1. Analysis of SCTR expression in human stomach.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Secretin R Antibody (3H1) Summary

Immunogen
SCTR (NP_002971, 32 a.a. - 141 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLK
Specificity
SCTR - secretin receptor (3H1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCTR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Secretin R Antibody (3H1)

  • pancreatic secretin receptor
  • SCTR
  • SCT-R
  • Secretin R
  • secretin receptor
  • SecretinR
  • SR

Background

The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
AF5540
Species: Mu
Applications: WB
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Secretin R Antibody (H00006344-M01) (0)

There are no publications for Secretin R Antibody (H00006344-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Secretin R Antibody (H00006344-M01) (0)

There are no reviews for Secretin R Antibody (H00006344-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Secretin R Antibody (H00006344-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Secretin R Products

Bioinformatics Tool for Secretin R Antibody (H00006344-M01)

Discover related pathways, diseases and genes to Secretin R Antibody (H00006344-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Secretin R Antibody (H00006344-M01)

Discover more about diseases related to Secretin R Antibody (H00006344-M01).
 

Pathways for Secretin R Antibody (H00006344-M01)

View related products by pathway.

PTMs for Secretin R Antibody (H00006344-M01)

Learn more about PTMs related to Secretin R Antibody (H00006344-M01).
 

Research Areas for Secretin R Antibody (H00006344-M01)

Find related products by research area.

Blogs on Secretin R

There are no specific blogs for Secretin R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Secretin R Antibody (3H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCTR
Entrez
Uniprot