SEC63 Antibody (1A8) - Azide and BSA Free

Western Blot: SEC63 Antibody (1A8) [H00011231-M04] - Analysis of SEC63 expression in transfected 293T cell line by SEC63 monoclonal antibody (M04), clone 1A8. Lane 1: SEC63 transfected lysate (Predicted MW: 36.52 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: SEC63 Antibody (1A8) [H00011231-M04] - Analysis of monoclonal antibody to SEC63 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: SEC63 Antibody (1A8) [H00011231-M04] - Detection limit for recombinant GST tagged SEC63 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1A8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SEC63 Antibody (1A8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SEC63 Antibody (1A8) - Azide and BSA Free (H00011231-M04) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SEC63 (NP_009145.1, 631 a.a. ~ 728 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSKITHPVYSLYFPEEKQEWWWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKPVPENHPQ
• Specificity: SEC63 - SEC63-like (S. cerevisiae) (1A8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SEC63
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SEC63 Antibody (1A8) - Azide and BSA Free

• PRO2507
• SEC63 homolog (S. cerevisiae)
• SEC63LERdj2
• SEC63-like (S. cerevisiae)
• translocation protein SEC63 homolog

Background

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEC63
• Entrez:
  • 11231(Human)
• Uniprot:
  • NP_009145(Human)