We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SEC3 Recombinant Protein Antigen

Images

 
There are currently no images for SEC3 Protein (NBP1-89957PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SEC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EXOC1.

Source: E. coli

Amino Acid Sequence: FKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EXOC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89957.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SEC3 Recombinant Protein Antigen

  • BM-102
  • exocyst complex component 1
  • Exocyst complex component Sec3
  • FLJ10893
  • SEC3L1
  • SEC3-like 1 (S. cerevisiae)
  • SEC3-like 1
  • SEC3P
  • SEC3Sec3p

Background

The EXOC1 (also known as SEC3) gene encodes an exocyst complex component 1 protein, that in isoform 1 is 894 amino acids long and nearly 102 kDA and in isoform 2 is 879 amino acids long and 100 kDA. The EXOC1 gene functions in the docking of exocytic vesicles with fusion sites on the plasma membrane. EXOC1 participates in the insulin pathway, Arf6 trafficking events, exocyst complex formation, and the metabolism of proteins through interacts with genes EXOC4, PKP3, LUC7L2, CDC5L, and C7orf55-LUC7L2. EXOC1 has been linked to toxic shock syndrome, schizophrenia, and mucopolysaccharidosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97492
Species: Bv, Ca, Ch, Fi, Gp, Ha, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-43031
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
7770-GT
Species: Hu
Applications: EnzAct
NB100-94901
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-85031
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-97500
Species: Bv, Ca, Ch, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ye
Applications: IB, ICC/IF, IHC,  IHC-P, WB
NBP2-93021
Species: Hu, Rt
Applications: ICC/IF, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-99472
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
202-IL
Species: Hu
Applications: BA
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89957PEP
Species: Hu
Applications: AC

Publications for SEC3 Protein (NBP1-89957PEP) (0)

There are no publications for SEC3 Protein (NBP1-89957PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC3 Protein (NBP1-89957PEP) (0)

There are no reviews for SEC3 Protein (NBP1-89957PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SEC3 Protein (NBP1-89957PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC3 Products

Research Areas for SEC3 Protein (NBP1-89957PEP)

Find related products by research area.

Blogs on SEC3

There are no specific blogs for SEC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SEC3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOC1