SEC14L4 Antibody

Images

 
Western Blot: SEC14L4 Antibody [NBP1-57591] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC14L4 Antibody Summary

Immunogen
Synthetic peptides corresponding to SEC14L4(SEC14-like 4 (S. cerevisiae)) The peptide sequence was selected from the N terminal of SEC14L4. Peptide sequence MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC14L4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SEC14L4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SEC14L4 Antibody

  • dJ130H16.5
  • SEC14-like 4 (S. cerevisiae)
  • SEC14p-like protein TAP3
  • TAP3SEC14-like protein 4
  • Tocopherol-associated protein 3

Background

SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-80882
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-490
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3444
Species: Hu
Applications: WB
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85855
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P
NBP1-57591
Species: Hu
Applications: WB

Publications for SEC14L4 Antibody (NBP1-57591) (0)

There are no publications for SEC14L4 Antibody (NBP1-57591).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC14L4 Antibody (NBP1-57591) (0)

There are no reviews for SEC14L4 Antibody (NBP1-57591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC14L4 Antibody (NBP1-57591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SEC14L4 Antibody (NBP1-57591)

Discover related pathways, diseases and genes to SEC14L4 Antibody (NBP1-57591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SEC14L4 Antibody (NBP1-57591)

View related products by pathway.

Blogs on SEC14L4

There are no specific blogs for SEC14L4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC14L4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC14L4
Uniprot