Recombinant Human SDHD Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SDHD Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-159 of Human SDHD full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL

Protein/Peptide Type
Recombinant Protein
Gene
SDHD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SDHD Protein

  • CBT1
  • CII-4
  • cybS
  • PGL
  • PGL1
  • QPs3
  • SDH4
  • succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
  • Succinate dehydrogenase complex subunit D
  • succinate dehydrogenase complex, subunit D, integral membrane protein
  • succinate dehydrogenase ubiquinone cytochrome B small subunit
  • Succinate-ubiquinone oxidoreductase cytochrome b small subunit
  • Succinate-ubiquinone reductase membrane anchor subunit

Background

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane. Mutations in SDHD have been linked to hereditary paraganglioma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006391-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NB100-485
Species: Hu
Applications: WB, IP
AF482
Species: Mu
Applications: WB, IHC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP1-92260
Species: Hu
Applications: WB, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91305
Species: Hu
Applications: WB
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006392-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SDHD Recombinant Protein (H00006392-P01) (0)

There are no publications for SDHD Recombinant Protein (H00006392-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDHD Recombinant Protein (H00006392-P01) (0)

There are no reviews for SDHD Recombinant Protein (H00006392-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SDHD Recombinant Protein (H00006392-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SDHD Products

Bioinformatics Tool for SDHD Recombinant Protein (H00006392-P01)

Discover related pathways, diseases and genes to SDHD Recombinant Protein (H00006392-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDHD Recombinant Protein (H00006392-P01)

Discover more about diseases related to SDHD Recombinant Protein (H00006392-P01).
 

Pathways for SDHD Recombinant Protein (H00006392-P01)

View related products by pathway.

PTMs for SDHD Recombinant Protein (H00006392-P01)

Learn more about PTMs related to SDHD Recombinant Protein (H00006392-P01).
 

Research Areas for SDHD Recombinant Protein (H00006392-P01)

Find related products by research area.

Blogs on SDHD.

HIF Antibodies: Beyond HIF-1 alpha
The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the...  Read full blog post.

Customers Who Bought This Also Bought

SDHD Antibody
NBP1-92372
SDHB Antibody
NBP1-87069

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SDHD Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SDHD