SDHD Antibody (3F4)

Images

 
Sandwich ELISA: SDHD Antibody (3F4) [H00006392-M04] - Detection limit for recombinant GST tagged SDHD is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SDHD Antibody (3F4) Summary

Immunogen
SDHD (AAH09574, 57 a.a. - 159 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
Specificity
SDHD (3F4)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SDHD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00006392-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SDHD Antibody (3F4)

  • CBT1
  • CII-4
  • cybS
  • PGL
  • PGL1
  • QPs3
  • SDH4
  • succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
  • Succinate dehydrogenase complex subunit D
  • succinate dehydrogenase complex, subunit D, integral membrane protein
  • succinate dehydrogenase ubiquinone cytochrome B small subunit
  • Succinate-ubiquinone oxidoreductase cytochrome b small subunit
  • Succinate-ubiquinone reductase membrane anchor subunit

Background

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane. Mutations in SDHD have been linked to hereditary paraganglioma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006391-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NB100-485
Species: Hu
Applications: WB, IP
AF482
Species: Mu
Applications: WB, IHC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP1-92260
Species: Hu
Applications: WB, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91305
Species: Hu
Applications: WB
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006392-M04
Species: Hu
Applications: WB, ELISA

Publications for SDHD Antibody (H00006392-M04)(1)

Reviews for SDHD Antibody (H00006392-M04) (0)

There are no reviews for SDHD Antibody (H00006392-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SDHD Antibody (H00006392-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SDHD Products

Bioinformatics Tool for SDHD Antibody (H00006392-M04)

Discover related pathways, diseases and genes to SDHD Antibody (H00006392-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDHD Antibody (H00006392-M04)

Discover more about diseases related to SDHD Antibody (H00006392-M04).
 

Pathways for SDHD Antibody (H00006392-M04)

View related products by pathway.

PTMs for SDHD Antibody (H00006392-M04)

Learn more about PTMs related to SDHD Antibody (H00006392-M04).
 

Research Areas for SDHD Antibody (H00006392-M04)

Find related products by research area.

Blogs on SDHD.

HIF Antibodies: Beyond HIF-1 alpha
The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SDHD Antibody (3F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SDHD
Entrez
OMIM
Uniprot