SDH Assembly Factor 1 Antibody

Images

 
Western Blot: SDH Assembly Factor 1 Antibody [NBP2-88226] - Host: Rabbit. Target Name: SDHAF1. Sample Tissue: Human 786-0 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SDH Assembly Factor 1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SDH Assembly Factor 1. Peptide sequence: IEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTGEPGGVGCQPDDGDSPR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SDHAF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SDH Assembly Factor 1 Antibody

  • LYR Motif Containing 8
  • LYR Motif-Containing Protein 8
  • LYRM8
  • SDHAF1
  • Succinate Dehydrogenase Assembly Factor 1, Mitochondrial
  • Succinate Dehydrogenase Complex Assembly Factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-74045
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92259
Species: Hu
Applications: IHC, IHC-P
NBP2-81948
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00006391-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF755
Species: Mu
Applications: WB, Block
NBP1-86182
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88673
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, Gp, Ha, Pm, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-56780
Species: Hu
Applications: WB, ICC/IF
NBP1-86799
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SDH Assembly Factor 1 Antibody (NBP2-88226) (0)

There are no publications for SDH Assembly Factor 1 Antibody (NBP2-88226).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDH Assembly Factor 1 Antibody (NBP2-88226) (0)

There are no reviews for SDH Assembly Factor 1 Antibody (NBP2-88226). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SDH Assembly Factor 1 Antibody (NBP2-88226) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SDH Assembly Factor 1 Products

Bioinformatics Tool for SDH Assembly Factor 1 Antibody (NBP2-88226)

Discover related pathways, diseases and genes to SDH Assembly Factor 1 Antibody (NBP2-88226). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDH Assembly Factor 1 Antibody (NBP2-88226)

Discover more about diseases related to SDH Assembly Factor 1 Antibody (NBP2-88226).
 

Pathways for SDH Assembly Factor 1 Antibody (NBP2-88226)

View related products by pathway.

Blogs on SDH Assembly Factor 1

There are no specific blogs for SDH Assembly Factor 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SDH Assembly Factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDHAF1