Recombinant Human SCP3/SYCP3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SCP3/SYCP3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-236 of Human SYCP3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SYCP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
54.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCP3/SYCP3 GST (N-Term) Protein

  • COR1
  • MGC71888
  • SCP3 chromosome 3 open reading frame 8
  • SCP3 COR1
  • SCP3
  • SCP-3
  • SYCP3
  • synaptonemal complex protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-03456
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
NBP2-94045
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF2030
Species: Hu
Applications: IHC, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP1-98492
Species: Hu, Mu
Applications: ICC, KO, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-2437
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP1-87144
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85958
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SCP3/SYCP3 Recombinant Protein (H00050511-P01) (0)

There are no publications for SCP3/SYCP3 Recombinant Protein (H00050511-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCP3/SYCP3 Recombinant Protein (H00050511-P01) (0)

There are no reviews for SCP3/SYCP3 Recombinant Protein (H00050511-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCP3/SYCP3 Recombinant Protein (H00050511-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCP3/SYCP3 Products

Bioinformatics Tool for SCP3/SYCP3 Recombinant Protein (H00050511-P01)

Discover related pathways, diseases and genes to SCP3/SYCP3 Recombinant Protein (H00050511-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCP3/SYCP3 Recombinant Protein (H00050511-P01)

Discover more about diseases related to SCP3/SYCP3 Recombinant Protein (H00050511-P01).
 

Pathways for SCP3/SYCP3 Recombinant Protein (H00050511-P01)

View related products by pathway.

PTMs for SCP3/SYCP3 Recombinant Protein (H00050511-P01)

Learn more about PTMs related to SCP3/SYCP3 Recombinant Protein (H00050511-P01).
 

Research Areas for SCP3/SYCP3 Recombinant Protein (H00050511-P01)

Find related products by research area.

Blogs on SCP3/SYCP3.

SCP3: A Key to Meiotic Recombination, Sterility and Cancer
Synaptonemal Complex Protein 3 (SCP3), which is a protein present in the synaptonemal complex which is responsible for pairing, synapsis, and recombination of homologous chromosomes during meiosis. Meiosis, in basic terms, is where germ cells divide t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCP3/SYCP3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCP3