We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Scn1a Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Scn1a Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-58876PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Scn1a Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Scn1a.

Source: E. coli

Amino Acid Sequence: NKCIQWPPTNASLEEHSIEKNITVNYNGTLI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCN1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58876.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Scn1a Recombinant Protein Antigen

  • brain I alpha subunit
  • DEE6
  • DEE6A
  • DEE6B
  • DRVT
  • EIEE6
  • FEB3
  • FEB3A
  • FHM3
  • GEFSP2
  • HBSCI
  • NAC1
  • Nav1.1
  • SCN1
  • SMEI
  • sodium channel, voltage-gated, type I, alpha polypeptide
  • sodium channel, voltage-gated, type I, alpha subunit

Background

Voltage-dependent sodium channels are heteromeric complexes that regulate sodium exchange between intracellular and extracellular spaces and are essential for the generation and propagation of action potentials in muscle cells and neurons. Each sodium channel is composed of a large pore-forming, glycosylated alpha subunit and two smaller beta subunits. This gene encodes a sodium channel alpha subunit, which has four homologous domains, each of which contains six transmembrane regions. Allelic variants of this gene are associated with generalized epilepsy with febrile seizures and epileptic encephalopathy. Alternative splicing results in multiple transcript variants. The RefSeq Project has decided to create four representative RefSeq records. Three of the transcript variants are supported by experimental evidence and the fourth contains alternate 5' untranslated exons, the exact combination of which have not been experimentally confirmed for the full-length transcript. [provided by RefSeq, Oct 2015]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006326-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-84177
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-94559
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-94560
Species: Hu
Applications: WB
NBP3-32061
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-17155
Species: Hu
Applications: IHC,  IHC-P
NB300-190
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
NBP2-12904
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, WB
NB110-61010
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, RIA, WB
NBP2-38820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF8375
Species: Hu
Applications: IHC, KO, WB
NBP3-29042
Species: Hu, Mu
Applications: IP, WB
NBP1-47615
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP3-48017
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82648
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP2-14040
Species: Hu
Applications: IHC,  IHC-P, WB
DFN00
Species: Hu
Applications: ELISA
6510-CA
Species: Hu
Applications: BA

Publications for Scn1a Recombinant Protein Antigen (NBP2-58876PEP) (0)

There are no publications for Scn1a Recombinant Protein Antigen (NBP2-58876PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Scn1a Recombinant Protein Antigen (NBP2-58876PEP) (0)

There are no reviews for Scn1a Recombinant Protein Antigen (NBP2-58876PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Scn1a Recombinant Protein Antigen (NBP2-58876PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Scn1a Products

Array NBP2-58876PEP

Blogs on Scn1a

There are no specific blogs for Scn1a, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Scn1a Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN1A