Scn1a Antibody

Immunocytochemistry/Immunofluorescence: Scn1a Antibody [NBP2-58876] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

Product Discontinued

Scn1a Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NKCIQWPPTNASLEEHSIEKNITVNYNGTLI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCN1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 87%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Scn1a Antibody

• brain I alpha subunit
• EIEE6
• FEB3
• GEFSP2FHM3
• HBSCI
• NAC1FEB3A
• Nav1.1
• SCN1
• SMEIfebrile convulsions 3
• sodium channel, voltage-gated, type I, alpha polypeptide
• sodium channel, voltage-gated, type I, alpha subunit

Background

Most excitable cells have these kind of voltage-gated sodium channels, these are responsible for generating and transmitting action potentials in neuronal cells. In brain these channels are heteromers made of alpha, beta1 and beta2 subunits. The alpha subunit forms the pore of the channel.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCN1A