Scn1a Antibody

Immunocytochemistry/Immunofluorescence: Scn1a Antibody [NBP2-58876] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

Product Discontinued

Scn1a Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NKCIQWPPTNASLEEHSIEKNITVNYNGTLI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCN1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 87%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Scn1a Antibody

• brain I alpha subunit
• DEE6
• DEE6A
• DEE6B
• DRVT
• EIEE6
• FEB3
• FEB3A
• FHM3
• GEFSP2
• HBSCI
• NAC1
• Nav1.1
• SCN1
• SMEI
• sodium channel, voltage-gated, type I, alpha polypeptide
• sodium channel, voltage-gated, type I, alpha subunit

Background

Voltage-dependent sodium channels are heteromeric complexes that regulate sodium exchange between intracellular and extracellular spaces and are essential for the generation and propagation of action potentials in muscle cells and neurons. Each sodium channel is composed of a large pore-forming, glycosylated alpha subunit and two smaller beta subunits. This gene encodes a sodium channel alpha subunit, which has four homologous domains, each of which contains six transmembrane regions. Allelic variants of this gene are associated with generalized epilepsy with febrile seizures and epileptic encephalopathy. Alternative splicing results in multiple transcript variants. The RefSeq Project has decided to create four representative RefSeq records. Three of the transcript variants are supported by experimental evidence and the fourth contains alternate 5' untranslated exons, the exact combination of which have not been experimentally confirmed for the full-length transcript. [provided by RefSeq, Oct 2015]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCN1A