Scn1a Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NKCIQWPPTNASLEEHSIEKNITVNYNGTLI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SCN1A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Scn1a Antibody
Background
Most excitable cells have these kind of voltage-gated sodium channels, these are responsible for generating and transmitting action potentials in neuronal cells. In brain these channels are heteromers made of alpha, beta1 and beta2 subunits. The alpha subunit forms the pore of the channel.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Publications for Scn1a Antibody (NBP2-58876) (0)
There are no publications for Scn1a Antibody (NBP2-58876).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Scn1a Antibody (NBP2-58876) (0)
There are no reviews for Scn1a Antibody (NBP2-58876).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Scn1a Antibody (NBP2-58876) (0)
Secondary Antibodies
| |
Isotype Controls
|
Blogs on Scn1a