Scn1a Antibody


Immunocytochemistry/ Immunofluorescence: Scn1a Antibody [NBP2-58876] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm & plasma membrane.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

Scn1a Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NKCIQWPPTNASLEEHSIEKNITVNYNGTLI
Specificity of human Scn1a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Scn1a Recombinant Protein Antigen (NBP2-58876PEP)

Reactivity Notes

Mouse 87%, Rat 84%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Scn1a Antibody

  • brain I alpha subunit
  • EIEE6
  • FEB3
  • Nav1.1
  • SCN1
  • SMEIfebrile convulsions 3
  • sodium channel, voltage-gated, type I, alpha polypeptide
  • sodium channel, voltage-gated, type I, alpha subunit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for Scn1a Antibody (NBP2-58876) (0)

There are no publications for Scn1a Antibody (NBP2-58876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Scn1a Antibody (NBP2-58876) (0)

There are no reviews for Scn1a Antibody (NBP2-58876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Scn1a Antibody (NBP2-58876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Scn1a Antibody (NBP2-58876)

Discover related pathways, diseases and genes to Scn1a Antibody (NBP2-58876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Scn1a Antibody (NBP2-58876)

Discover more about diseases related to Scn1a Antibody (NBP2-58876).

Pathways for Scn1a Antibody (NBP2-58876)

View related products by pathway.

PTMs for Scn1a Antibody (NBP2-58876)

Learn more about PTMs related to Scn1a Antibody (NBP2-58876).

Blogs on Scn1a

There are no specific blogs for Scn1a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Scn1a Antibody and receive a gift card or discount.


Gene Symbol SCN1A