SCN11A Antibody (6E1) - Azide and BSA Free

ELISA: SCN11A Antibody (6E1) [H00011280-M04] - Detection limit for recombinant GST tagged SCN11A is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6E1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SCN11A Antibody (6E1) - Azide and BSA Free Summary

• Immunogen: SCN11A (NP_054858, 1726 a.a. ~ 1791 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
• Specificity: SCN11A (6E1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SCN11A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCN11A Antibody (6E1) - Azide and BSA Free

• hNaN
• NaN
• Nav1.9
• Peripheral nerve sodium channel 5
• PN5
• SCN11A
• SCN12A
• SNS2
• SNS-2
• sodium channel, voltage-gated, type XI, alpha polypeptide
• sodium channel, voltage-gated, type XI, alpha subunit
• sodium channel, voltage-gated, type XII, alpha
• voltage-gated sodium channel Nav1.9
• Voltage-gated sodium channel subunit alpha Nav1.9
• voltage-gated, type XII, alpha polypeptide

Background

Voltage-gated sodium channels are membrane protein complexes that play a fundamental role in the rising phase of the action potential in most excitable cells. Alpha subunits, such as SCN11A, mediate voltage-dependent gating and conductance, while auxiliary beta subunits regulate the kinetic properties of the channel and facilitate membrane localization of the complex. Aberrant expression patterns or mutations of alpha subunits underlie a number of disorders. Each alpha subunit consists of 4 domains connected by 3 intracellular loops; each domain consists of 6 transmembrane segments and intra- and extracellular linkers.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCN11A
• Entrez:
  • 11280(Human)
• OMIM:
  • 604385(Human)
• Uniprot:
  • NP_054858(Human)