SCML2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SCML2 Antibody [NBP2-56280] - Staining in human testis and skeletal muscle tissues using anti-SCML2 antibody. Corresponding SCML2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: SCML2 Antibody [NBP2-56280] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: SCML2 Antibody [NBP2-56280] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SCML2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRSVPGTTSSPLVGDISPKSSPHEVKFQMQRKSEAPSYIAVPDPSVLKQGFSKDPSTWSVDEVIQFMKHTDPQISGPLADLFR
Specificity
Specificity of human SCML2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCML2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCML2 Recombinant Protein Antigen (NBP2-56280PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SCML2 Antibody

  • sex comb on midleg (Drosophila)-like 2
  • sex comb on midleg-like 2 (Drosophila)
  • sex comb on midleg-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
H00006322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-56487
Species: Hu
Applications: IHC, IHC-P
NBP1-84881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-20932
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45724
Species: Hu
Applications: WB, IHC
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32447
Species: Hu
Applications: WB, ICC/IF
NBP2-38127
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1240
Species: Hu
Applications: WB, PEP-ELISA
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC, IHC-P

Publications for SCML2 Antibody (NBP2-56280) (0)

There are no publications for SCML2 Antibody (NBP2-56280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCML2 Antibody (NBP2-56280) (0)

There are no reviews for SCML2 Antibody (NBP2-56280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCML2 Antibody (NBP2-56280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SCML2 Products

Bioinformatics Tool for SCML2 Antibody (NBP2-56280)

Discover related pathways, diseases and genes to SCML2 Antibody (NBP2-56280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCML2 Antibody (NBP2-56280)

Discover more about diseases related to SCML2 Antibody (NBP2-56280).
 

Pathways for SCML2 Antibody (NBP2-56280)

View related products by pathway.

PTMs for SCML2 Antibody (NBP2-56280)

Learn more about PTMs related to SCML2 Antibody (NBP2-56280).

Blogs on SCML2

There are no specific blogs for SCML2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCML2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCML2